Protein Labeling Reagents
- (110)
- (17)
- (2)
- (7)
- (1)
- (38)
- (2)
- (1)
- (17)
- (7)
- (4)
- (15)
- (16)
- (8)
- (2)
- (1)
- (10)
- (5)
- (17)
- (1)
- (2)
- (16)
- (6)
- (6)
- (5)
- (15)
- (89)
- (17)
- (8)
- (66)
- (2)
- (2)
- (38)
- (4)
- (18)
- (3)
- (17)
- (5)
- (6)
- (1)
- (22)
- (2)
- (2)
- (2)
- (6)
- (6)
- (12)
- (27)
- (1)
- (2)
- (1)
- (11)
- (1)
- (4)
- (30)
- (1)
- (1)
- (2)
- (8)
- (6)
- (5)
- (5)
- (5)
- (5)
- (1)
- (6)
- (47)
- (2)
- (3)
- (3)
- (5)
- (5)
- (41)
- (44)
- (35)
Filtered Search Results
Meso Scale Discovery U-PLEX Mouse IL-17A/F ASYQP
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
The U-PLEX Mouse IL-17A/F Assay (K152VYK) is a multiplex immunoassay kit from Meso Scale Discovery designed to simultaneously measure interleukin-17A and IL-17F cytokine levels in mouse biological samples This electrochemiluminescence-based assay provides high sensitivity detection with minimal sample volume requirements making it ideal for research applications studying inflammatory responses autoimmune diseases and immune system function in mouse models
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Biotium CF660C Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
This product is prepared by labeling highly cross-adsorbed goat anti-rabbit IgG (H+L) with CF660C dye. CF dyes are Biotium's line of next-generation fluorescent dyes with advantages in brightness, photostability, and conjugate specificity compared to other fluorescent dyes. Far-red fluorescent CF660C dye has excitation/emission at 667/685 nm. To minimize cross-reactivity, the antibody has been adsorbed against human, mouse, and rat serum. Single label antibodies have an average of one dye molecule per antibody molecule, which is reported to be optimal for super-resolution imaging by STORM.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / Sulfo-Cy7 bis-NHS ester / 1mg / 761705603 / BP-28890 / / / [null] / 1041.240 / C50H57KN4O14S2
Broadpharm / Sulfo-Cy7 bis-NHS ester / 1mg / 761705603 / BP-28890 / / / [null] / 1041.240 / C50H57KN4O14S2
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / BDP 558/568 DBCO / 1mg / 761705868 / BP-28961 / / / [null] / 646.560 / C37H33BF2N4O2S
Broadpharm / BDP 558/568 DBCO / 1mg / 761705868 / BP-28961 / / / [null] / 646.560 / C37H33BF2N4O2S
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Sartorius Human IL-17A T Cell Companion
The iQue Human T Cell Companion Kits can be used to measure additional cytokines besides those already included in the Human T Cell Immunology portfolio of Kits.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Biotium Tyramide Amplification Kit with HRP Streptavidin and Biotin-XX Tyramide
Tyramide amplification, sometimes called Catalyzed Reporter Deposition (CARD), is an enzyme-mediated detection method that uses the catalytic activity of horseradish peroxidase (HRP) to generate high density labeling of a target protein or nucleic acid sequence in situ. The tyramide amplification method has been reported to increase the sensitivity by up to 100-fold compared to the conventional avidin-biotinylated complex procedure. The kit contains HRP streptavidin Biotin-XX tyramide. The kit contains sufficient reagent for 50-150 slides.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
AnaSpec B AMYLOIED (1-40) HILYTE FLUR
Beta-Amyloid (1-40), HiLyte(TM) Fluor 488-labeled, Human[HiLyte(TM) Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4686.3; (0.1 mg) This is a fluorescent (HiLyte(TM) Fluor 488)-labeled B-Amyloid peptide, Abs/Em=503/528 nm.
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
eMolecules Broadpharm / MB 660R NHS Ester / 1mg / 713699953 / BP-28147 / / 1201771-13-2 / [null] / 840.930 / C35H44N4O14S3
Broadpharm / MB 660R NHS Ester / 1mg / 713699953 / BP-28147 / / 1201771-13-2 / [null] / 840.930 / C35H44N4O14S3
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
TENOVA PHARMACEUTICALS INC HALOTAG TMR LIGAND
NC2749360 HALOTAG TMR LIGAND
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Thermo Scientific MAINTENANCE KIT FOR HPG-3200BX
NC3234315 MAINTENANCE KIT FOR HPG-3200BX
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Lumiprobe LUMIPROBE
NC3948338 HPG L-HOMOPROPARGYLGLYCINE
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical 12-methyl MyrIstIc AcId 5mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
A methylated fatty acid; has been found in bacteria, dairy products, wild-caught and farm-raised saltwater fish, and mouse subcutaneous adipose tissue; reduces larval settlement of H. elegans in a concentration-dependent manner (0.625-40 μg/ml); levels are decreased in mice fed a high-fat diet
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Cayman Chemical MyrIstIc ACD methyl STRd2 50mg
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
An internal standard for the quantification of myristic acid methyl ester by GC- or LC-MS
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
American Research Products Inc LONG ARM BIOTIN LABELING KIT
5000265683 LONG ARM BIOTIN LABELING KIT
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
American Research Products Inc WATER SOLUBLE LONG ARM BIOTIN
5000265686 WATER SOLUBLE LONG ARM BIOTIN
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More